PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG191700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 26432.4 Da    PI: 9.3622
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG191700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.97.6e-251058250
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         rien   rqvtfskRr g+lKKA+ELSvLCda++ vi+fs++g +ye +
  Pavir.7NG191700.1.p 10 RIENPAHRQVTFSKRRMGLLKKANELSVLCDADIGVIVFSPHGMMYELA 58
                         8*********************************************965 PP

2K-box50.78e-1877158484
                K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                          ++g s  ++k +   qe+  L +eie Lq+ +R   Ge d++ +sl eL++Le++Le  +++iRs+K++++ ++ie l++k 
  Pavir.7NG191700.1.p  77 TQGASRRKKKPQAIPQEVLALTREIELLQKGLRYKYGEsDINHMSLGELHSLESNLEIWVQNIRSQKMQIMSMEIEMLRNKV 158
                          6778889999***************************967***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.212161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.16E-26175IPR002100Transcription factor, MADS-box
CDDcd002657.16E-35272No hitNo description
PRINTSPR004041.2E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.2E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-253859IPR002100Transcription factor, MADS-box
PfamPF014864.4E-1984158IPR002487Transcription factor, K-box
PROSITE profilePS5129711.78887210IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MARGKVQIRR IENPAHRQVT FSKRRMGLLK KANELSVLCD ADIGVIVFSP HGMMYELATN  60
GNMQVLVERY KTAFGETQGA SRRKKKPQAI PQEVLALTRE IELLQKGLRY KYGESDINHM  120
SLGELHSLES NLEIWVQNIR SQKMQIMSME IEMLRNKVGS ACSFLAPVTN SSLHIQETSS  180
VAPFSNVFQE DILQATNDIF QEKISEQNGI LNASGSVMVP QVPFQLNRGS NYYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-15168168Myocyte-specific enhancer factor 2B
1tqe_Q3e-15168168Myocyte-specific enhancer factor 2B
1tqe_R3e-15168168Myocyte-specific enhancer factor 2B
1tqe_S3e-15168168Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18186RRKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.11e-101PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK91e-65MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-65MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLK3YEG81e-101K3YEG8_SETIT; Uncharacterized protein
STRINGSi012632m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-49AGAMOUS-like 12